Anti TM9SF2 pAb (ATL-HPA005657)

Atlas Antibodies

Catalog No.: ATL-HPA005657-25

Protein Description: transmembrane 9 superfamily member 2
Gene Name: TM9SF2
Alternative Gene Name: P76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025544: 96%, ENSRNOG00000012751: 96%
Entrez Gene ID: 9375
Uniprot ID: Q99805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRF
• Gene Sequence: LFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRF
• Gene ID - Mouse: ENSMUSG00000025544
• Gene ID - Rat: ENSRNOG00000012751
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TM9SF2 pAb (ATL-HPA005657) – 1 Found

Clark, Christopher R; Maile, Makayla; Blaney, Patrick; Hellweg, Stefano R; Strauss, Anna; Durose, Wilaiwan; Priya, Sambhawa; Habicht, Juri; Burns, Michael B; Blekhman, Ran; Abrahante, Juan E; Starr, Timothy K. Transposon mutagenesis screen in mice identifies TM9SF2 as a novel colorectal cancer oncogene. Scientific Reports. 2018;8(1):15327.