Anti TM9SF1 pAb (ATL-HPA059249)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059249-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: TM9SF1
Alternative Gene Name: HMP70, MP70
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002320: 93%, ENSRNOG00000019710: 93%
Entrez Gene ID: 10548
Uniprot ID: O15321
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP |
Gene Sequence | RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP |
Gene ID - Mouse | ENSMUSG00000002320 |
Gene ID - Rat | ENSRNOG00000019710 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TM9SF1 pAb (ATL-HPA059249) | |
Datasheet | Anti TM9SF1 pAb (ATL-HPA059249) Datasheet (External Link) |
Vendor Page | Anti TM9SF1 pAb (ATL-HPA059249) at Atlas Antibodies |
Documents & Links for Anti TM9SF1 pAb (ATL-HPA059249) | |
Datasheet | Anti TM9SF1 pAb (ATL-HPA059249) Datasheet (External Link) |
Vendor Page | Anti TM9SF1 pAb (ATL-HPA059249) |