Anti TM2D3 pAb (ATL-HPA054064)

Atlas Antibodies

Catalog No.:
ATL-HPA054064-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TM2 domain containing 3
Gene Name: TM2D3
Alternative Gene Name: BLP2, FLJ22604
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078681: 85%, ENSRNOG00000011290: 79%
Entrez Gene ID: 80213
Uniprot ID: Q9BRN9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
Gene Sequence IPPYVMKCPSNGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTNSTSCMTVSC
Gene ID - Mouse ENSMUSG00000078681
Gene ID - Rat ENSRNOG00000011290
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TM2D3 pAb (ATL-HPA054064)
Datasheet Anti TM2D3 pAb (ATL-HPA054064) Datasheet (External Link)
Vendor Page Anti TM2D3 pAb (ATL-HPA054064) at Atlas Antibodies

Documents & Links for Anti TM2D3 pAb (ATL-HPA054064)
Datasheet Anti TM2D3 pAb (ATL-HPA054064) Datasheet (External Link)
Vendor Page Anti TM2D3 pAb (ATL-HPA054064)