Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA050547-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TM2 domain containing 2
Gene Name: TM2D2
Alternative Gene Name: BLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031556: 93%, ENSRNOG00000016559: 91%
Entrez Gene ID: 83877
Uniprot ID: Q9BX73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTG
Gene Sequence TASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTG
Gene ID - Mouse ENSMUSG00000031556
Gene ID - Rat ENSRNOG00000016559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation)
Datasheet Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation)
Datasheet Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TM2D2 pAb (ATL-HPA050547 w/enhanced validation)