Anti TM2D2 pAb (ATL-HPA047152)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047152-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TM2D2
Alternative Gene Name: BLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031556: 73%, ENSRNOG00000016559: 73%
Entrez Gene ID: 83877
Uniprot ID: Q9BX73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNAT |
Gene Sequence | TAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNAT |
Gene ID - Mouse | ENSMUSG00000031556 |
Gene ID - Rat | ENSRNOG00000016559 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TM2D2 pAb (ATL-HPA047152) | |
Datasheet | Anti TM2D2 pAb (ATL-HPA047152) Datasheet (External Link) |
Vendor Page | Anti TM2D2 pAb (ATL-HPA047152) at Atlas Antibodies |
Documents & Links for Anti TM2D2 pAb (ATL-HPA047152) | |
Datasheet | Anti TM2D2 pAb (ATL-HPA047152) Datasheet (External Link) |
Vendor Page | Anti TM2D2 pAb (ATL-HPA047152) |