Anti TM2D1 pAb (ATL-HPA055621)

Atlas Antibodies

Catalog No.:
ATL-HPA055621-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TM2 domain containing 1
Gene Name: TM2D1
Alternative Gene Name: BBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013155: 38%, ENSRNOG00000051291: 35%
Entrez Gene ID: 83941
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSPNVIPRAHGQKNTRRDGTGLYPMRGPFKNLAL
Gene Sequence GSPNVIPRAHGQKNTRRDGTGLYPMRGPFKNLAL
Gene ID - Mouse ENSMUSG00000013155
Gene ID - Rat ENSRNOG00000051291
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TM2D1 pAb (ATL-HPA055621)
Datasheet Anti TM2D1 pAb (ATL-HPA055621) Datasheet (External Link)
Vendor Page Anti TM2D1 pAb (ATL-HPA055621) at Atlas Antibodies

Documents & Links for Anti TM2D1 pAb (ATL-HPA055621)
Datasheet Anti TM2D1 pAb (ATL-HPA055621) Datasheet (External Link)
Vendor Page Anti TM2D1 pAb (ATL-HPA055621)