Anti TM2D1 pAb (ATL-HPA046058)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046058-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TM2D1
Alternative Gene Name: BBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028563: 90%, ENSRNOG00000007527: 92%
Entrez Gene ID: 83941
Uniprot ID: Q9BX74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG |
| Gene Sequence | CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG |
| Gene ID - Mouse | ENSMUSG00000028563 |
| Gene ID - Rat | ENSRNOG00000007527 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TM2D1 pAb (ATL-HPA046058) | |
| Datasheet | Anti TM2D1 pAb (ATL-HPA046058) Datasheet (External Link) |
| Vendor Page | Anti TM2D1 pAb (ATL-HPA046058) at Atlas Antibodies |
| Documents & Links for Anti TM2D1 pAb (ATL-HPA046058) | |
| Datasheet | Anti TM2D1 pAb (ATL-HPA046058) Datasheet (External Link) |
| Vendor Page | Anti TM2D1 pAb (ATL-HPA046058) |