Anti TLX3 pAb (ATL-HPA060957)

Atlas Antibodies

Catalog No.: ATL-HPA060957-25

Protein Description: T-cell leukemia homeobox 3
Gene Name: TLX3
Alternative Gene Name: HOX11L2, RNX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040610: 100%, ENSRNOG00000004976: 100%
Entrez Gene ID: 30012
Uniprot ID: O43711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
• Gene Sequence: PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
• Gene ID - Mouse: ENSMUSG00000040610
• Gene ID - Rat: ENSRNOG00000004976
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.