Anti TLX3 pAb (ATL-HPA060957)

Atlas Antibodies

Catalog No.:
ATL-HPA060957-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: T-cell leukemia homeobox 3
Gene Name: TLX3
Alternative Gene Name: HOX11L2, RNX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040610: 100%, ENSRNOG00000004976: 100%
Entrez Gene ID: 30012
Uniprot ID: O43711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
Gene Sequence PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA
Gene ID - Mouse ENSMUSG00000040610
Gene ID - Rat ENSRNOG00000004976
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TLX3 pAb (ATL-HPA060957)
Datasheet Anti TLX3 pAb (ATL-HPA060957) Datasheet (External Link)
Vendor Page Anti TLX3 pAb (ATL-HPA060957) at Atlas Antibodies

Documents & Links for Anti TLX3 pAb (ATL-HPA060957)
Datasheet Anti TLX3 pAb (ATL-HPA060957) Datasheet (External Link)
Vendor Page Anti TLX3 pAb (ATL-HPA060957)