Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059613-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: TLR7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044583: 78%, ENSRNOG00000004249: 80%
Entrez Gene ID: 51284
Uniprot ID: Q9NYK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL |
Gene Sequence | MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL |
Gene ID - Mouse | ENSMUSG00000044583 |
Gene ID - Rat | ENSRNOG00000004249 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) | |
Datasheet | Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) | |
Datasheet | Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) |
Citations for Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) – 1 Found |
Cameron, S A; White, S M; Arrollo, D; Shulman, S T; Rowley, A H. Arterial immune protein expression demonstrates the complexity of immune responses in Kawasaki disease arteritis. Clinical And Experimental Immunology. 2017;190(2):244-250. PubMed |