Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA059613-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: toll-like receptor 7
Gene Name: TLR7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044583: 78%, ENSRNOG00000004249: 80%
Entrez Gene ID: 51284
Uniprot ID: Q9NYK1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL
Gene Sequence MLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWREGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNL
Gene ID - Mouse ENSMUSG00000044583
Gene ID - Rat ENSRNOG00000004249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation)
Datasheet Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation)
Datasheet Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation)
Citations for Anti TLR7 pAb (ATL-HPA059613 w/enhanced validation) – 1 Found
Cameron, S A; White, S M; Arrollo, D; Shulman, S T; Rowley, A H. Arterial immune protein expression demonstrates the complexity of immune responses in Kawasaki disease arteritis. Clinical And Experimental Immunology. 2017;190(2):244-250.  PubMed