Anti TLR6 pAb (ATL-HPA062733)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062733-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TLR6
Alternative Gene Name: CD286
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051498: 68%, ENSRNOG00000002161: 66%
Entrez Gene ID: 10333
Uniprot ID: Q9Y2C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD |
| Gene Sequence | FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD |
| Gene ID - Mouse | ENSMUSG00000051498 |
| Gene ID - Rat | ENSRNOG00000002161 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TLR6 pAb (ATL-HPA062733) | |
| Datasheet | Anti TLR6 pAb (ATL-HPA062733) Datasheet (External Link) |
| Vendor Page | Anti TLR6 pAb (ATL-HPA062733) at Atlas Antibodies |
| Documents & Links for Anti TLR6 pAb (ATL-HPA062733) | |
| Datasheet | Anti TLR6 pAb (ATL-HPA062733) Datasheet (External Link) |
| Vendor Page | Anti TLR6 pAb (ATL-HPA062733) |