Anti TLR6 pAb (ATL-HPA062733)

Atlas Antibodies

Catalog No.:
ATL-HPA062733-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: toll-like receptor 6
Gene Name: TLR6
Alternative Gene Name: CD286
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051498: 68%, ENSRNOG00000002161: 66%
Entrez Gene ID: 10333
Uniprot ID: Q9Y2C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD
Gene Sequence FKVGLMTKDMPSLEILDVSWNSLESGRHKENCTWVESIVVLNLSSNMLTD
Gene ID - Mouse ENSMUSG00000051498
Gene ID - Rat ENSRNOG00000002161
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TLR6 pAb (ATL-HPA062733)
Datasheet Anti TLR6 pAb (ATL-HPA062733) Datasheet (External Link)
Vendor Page Anti TLR6 pAb (ATL-HPA062733) at Atlas Antibodies

Documents & Links for Anti TLR6 pAb (ATL-HPA062733)
Datasheet Anti TLR6 pAb (ATL-HPA062733) Datasheet (External Link)
Vendor Page Anti TLR6 pAb (ATL-HPA062733)