Anti TLR4 pAb (ATL-HPA049174)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049174-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: TLR4
Alternative Gene Name: ARMD10, CD284, hToll, TLR-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039005: 64%, ENSRNOG00000010522: 62%
Entrez Gene ID: 7099
Uniprot ID: O00206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP |
| Gene Sequence | LQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATP |
| Gene ID - Mouse | ENSMUSG00000039005 |
| Gene ID - Rat | ENSRNOG00000010522 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TLR4 pAb (ATL-HPA049174) | |
| Datasheet | Anti TLR4 pAb (ATL-HPA049174) Datasheet (External Link) |
| Vendor Page | Anti TLR4 pAb (ATL-HPA049174) at Atlas Antibodies |
| Documents & Links for Anti TLR4 pAb (ATL-HPA049174) | |
| Datasheet | Anti TLR4 pAb (ATL-HPA049174) Datasheet (External Link) |
| Vendor Page | Anti TLR4 pAb (ATL-HPA049174) |