Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA004748-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: talin 1
Gene Name: TLN1
Alternative Gene Name: ILWEQ, TLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028465: 99%, ENSRNOG00000016630: 100%
Entrez Gene ID: 7094
Uniprot ID: Q9Y490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP
Gene Sequence LLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSP
Gene ID - Mouse ENSMUSG00000028465
Gene ID - Rat ENSRNOG00000016630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation)
Datasheet Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation)
Datasheet Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation)
Citations for Anti TLN1 pAb (ATL-HPA004748 w/enhanced validation) – 2 Found
Thapa, Narendra; Choi, Suyong; Hedman, Andrew; Tan, Xiaojun; Anderson, Richard A. Phosphatidylinositol phosphate 5-kinase Iγi2 in association with Src controls anchorage-independent growth of tumor cells. The Journal Of Biological Chemistry. 2013;288(48):34707-18.  PubMed
Philippe, Monique; Léger, Thibaut; Desvaux, Raphaëlle; Walch, Laurence. Discs large 1 (Dlg1) scaffolding protein participates with clathrin and adaptator protein complex 1 (AP-1) in forming Weibel-Palade bodies of endothelial cells. The Journal Of Biological Chemistry. 2013;288(18):13046-56.  PubMed