Anti TLE2 pAb (ATL-HPA049103)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049103-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TLE2
Alternative Gene Name: ESG, ESG2, FLJ41188, GRG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034771: 92%, ENSRNOG00000005874: 94%
Entrez Gene ID: 7089
Uniprot ID: Q04725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP |
Gene Sequence | SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP |
Gene ID - Mouse | ENSMUSG00000034771 |
Gene ID - Rat | ENSRNOG00000005874 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TLE2 pAb (ATL-HPA049103) | |
Datasheet | Anti TLE2 pAb (ATL-HPA049103) Datasheet (External Link) |
Vendor Page | Anti TLE2 pAb (ATL-HPA049103) at Atlas Antibodies |
Documents & Links for Anti TLE2 pAb (ATL-HPA049103) | |
Datasheet | Anti TLE2 pAb (ATL-HPA049103) Datasheet (External Link) |
Vendor Page | Anti TLE2 pAb (ATL-HPA049103) |