Anti TLE2 pAb (ATL-HPA049103)

Atlas Antibodies

Catalog No.:
ATL-HPA049103-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: transducin-like enhancer of split 2
Gene Name: TLE2
Alternative Gene Name: ESG, ESG2, FLJ41188, GRG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034771: 92%, ENSRNOG00000005874: 94%
Entrez Gene ID: 7089
Uniprot ID: Q04725
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP
Gene Sequence SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP
Gene ID - Mouse ENSMUSG00000034771
Gene ID - Rat ENSRNOG00000005874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TLE2 pAb (ATL-HPA049103)
Datasheet Anti TLE2 pAb (ATL-HPA049103) Datasheet (External Link)
Vendor Page Anti TLE2 pAb (ATL-HPA049103) at Atlas Antibodies

Documents & Links for Anti TLE2 pAb (ATL-HPA049103)
Datasheet Anti TLE2 pAb (ATL-HPA049103) Datasheet (External Link)
Vendor Page Anti TLE2 pAb (ATL-HPA049103)