Anti TLDC2 pAb (ATL-HPA047468)

Atlas Antibodies

Catalog No.:
ATL-HPA047468-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TBC/LysM-associated domain containing 2
Gene Name: TLDC2
Alternative Gene Name: C20orf118, dJ132F21.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074628: 87%, ENSRNOG00000006395: 85%
Entrez Gene ID: 140711
Uniprot ID: A0PJX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSK
Gene Sequence EASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSK
Gene ID - Mouse ENSMUSG00000074628
Gene ID - Rat ENSRNOG00000006395
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TLDC2 pAb (ATL-HPA047468)
Datasheet Anti TLDC2 pAb (ATL-HPA047468) Datasheet (External Link)
Vendor Page Anti TLDC2 pAb (ATL-HPA047468) at Atlas Antibodies

Documents & Links for Anti TLDC2 pAb (ATL-HPA047468)
Datasheet Anti TLDC2 pAb (ATL-HPA047468) Datasheet (External Link)
Vendor Page Anti TLDC2 pAb (ATL-HPA047468)