Anti TLDC2 pAb (ATL-HPA047468)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047468-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TLDC2
Alternative Gene Name: C20orf118, dJ132F21.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074628: 87%, ENSRNOG00000006395: 85%
Entrez Gene ID: 140711
Uniprot ID: A0PJX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSK |
Gene Sequence | EASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSK |
Gene ID - Mouse | ENSMUSG00000074628 |
Gene ID - Rat | ENSRNOG00000006395 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TLDC2 pAb (ATL-HPA047468) | |
Datasheet | Anti TLDC2 pAb (ATL-HPA047468) Datasheet (External Link) |
Vendor Page | Anti TLDC2 pAb (ATL-HPA047468) at Atlas Antibodies |
Documents & Links for Anti TLDC2 pAb (ATL-HPA047468) | |
Datasheet | Anti TLDC2 pAb (ATL-HPA047468) Datasheet (External Link) |
Vendor Page | Anti TLDC2 pAb (ATL-HPA047468) |