Anti TKTL1 pAb (ATL-HPA000505 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000505-25

Protein Description: transketolase-like 1
Gene Name: TKTL1
Alternative Gene Name: TKR, TKT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031397: 70%, ENSRNOG00000055557: 73%
Entrez Gene ID: 8277
Uniprot ID: P51854
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESS
• Gene Sequence: SFSHPTSCSSSSEIMSVLFFYIMRYKQSDPENPDNDRFVLAKRLSFVDVATGWLGQGLGVACGMAYTGKYFDRASYRVFCLMSDGESS
• Gene ID - Mouse: ENSMUSG00000031397
• Gene ID - Rat: ENSRNOG00000055557
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TKTL1 pAb (ATL-HPA000505 w/enhanced validation) – 1 Found

Kämmerer, Ulrike; Gires, Olivier; Pfetzer, Nadja; Wiegering, Armin; Klement, Rainer Johannes; Otto, Christoph. TKTL1 expression in human malign and benign cell lines. Bmc Cancer. 2015;15( 26187043):2.