Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053337-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tight junction protein 3
Gene Name: TJP3
Alternative Gene Name: ZO-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034917: 74%, ENSRNOG00000020501: 75%
Entrez Gene ID: 27134
Uniprot ID: O95049
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS
Gene Sequence VMVNGVSMENATSAFAIQILKTCTKMANITVKRPRRIHLPATKASPSSPGRQDSDEDDGPQRVEEVDQGRGYDGDSSSGS
Gene ID - Mouse ENSMUSG00000034917
Gene ID - Rat ENSRNOG00000020501
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation)
Datasheet Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation)
Datasheet Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation)
Citations for Anti TJP3 pAb (ATL-HPA053337 w/enhanced validation) – 1 Found
Ueda, Mitsunobu; Kobayashi, Hidetomo; Seike, Soshi; Takahashi, Eizo; Okamoto, Keinosuke; Yamanaka, Hiroyasu. Aeromonas sobria Serine Protease Degrades Several Protein Components of Tight Junctions and Assists Bacterial Translocation Across the T84 Monolayer. Frontiers In Cellular And Infection Microbiology. 12( 35273923):824547.  PubMed