Anti TJP2 pAb (ATL-HPA070714)

Atlas Antibodies

SKU:
ATL-HPA070714-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & cell junctions.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: tight junction protein 2
Gene Name: TJP2
Alternative Gene Name: DFNA51, X104, ZO-2, ZO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024812: 74%, ENSRNOG00000015030: 73%
Entrez Gene ID: 9414
Uniprot ID: Q9UDY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT
Gene Sequence QHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPT
Gene ID - Mouse ENSMUSG00000024812
Gene ID - Rat ENSRNOG00000015030
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti TJP2 pAb (ATL-HPA070714)
Datasheet Anti TJP2 pAb (ATL-HPA070714) Datasheet (External Link)
Vendor Page Anti TJP2 pAb (ATL-HPA070714) at Atlas Antibodies

Documents & Links for Anti TJP2 pAb (ATL-HPA070714)
Datasheet Anti TJP2 pAb (ATL-HPA070714) Datasheet (External Link)
Vendor Page Anti TJP2 pAb (ATL-HPA070714)