Anti TJP2 pAb (ATL-HPA001813 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001813-25

Protein Description: tight junction protein 2
Gene Name: TJP2
Alternative Gene Name: DFNA51, X104, ZO-2, ZO2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024812: 92%, ENSRNOG00000015030: 91%
Entrez Gene ID: 9414
Uniprot ID: Q9UDY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
• Gene Sequence: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
• Gene ID - Mouse: ENSMUSG00000024812
• Gene ID - Rat: ENSRNOG00000015030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TJP2 pAb (ATL-HPA001813 w/enhanced validation) – 1 Found

González-Andrades, M; Garzón, I; Gascón, M I; Muñoz-Avila, J I; Sánchez-Quevedo, M C; Campos, A; Alaminos, M. Sequential development of intercellular junctions in bioengineered human corneas. Journal Of Tissue Engineering And Regenerative Medicine. 2009;3(6):442-9.