Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001636-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: TJP1
Alternative Gene Name: DKFZp686M05161, MGC133289, ZO-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030516: 100%, ENSRNOG00000011077: 100%
Entrez Gene ID: 7082
Uniprot ID: Q07157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED |
| Gene Sequence | RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED |
| Gene ID - Mouse | ENSMUSG00000030516 |
| Gene ID - Rat | ENSRNOG00000011077 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) | |
| Datasheet | Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) | |
| Datasheet | Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) |
| Citations for Anti TJP1 pAb (ATL-HPA001636 w/enhanced validation) – 8 Found |
| Chen, Huanhuan Joyce; Wei, Zhubo; Sun, Jian; Bhattacharya, Asmita; Savage, David J; Serda, Rita; Mackeyev, Yuri; Curley, Steven A; Bu, Pengcheng; Wang, Lihua; Chen, Shuibing; Cohen-Gould, Leona; Huang, Emina; Shen, Xiling; Lipkin, Steven M; Copeland, Neal G; Jenkins, Nancy A; Shuler, Michael L. A recellularized human colon model identifies cancer driver genes. Nature Biotechnology. 2016;34(8):845-51. PubMed |
| Ito, Shoko; Okuda, Satoru; Abe, Masako; Fujimoto, Mari; Onuki, Tetsuo; Nishimura, Tamako; Takeichi, Masatoshi. Induced cortical tension restores functional junctions in adhesion-defective carcinoma cells. Nature Communications. 2017;8(1):1834. PubMed |
| Chen, Huanhuan Joyce; Miller, Paula; Shuler, Michael L. A pumpless body-on-a-chip model using a primary culture of human intestinal cells and a 3D culture of liver cells. Lab On A Chip. 2018;18(14):2036-2046. PubMed |
| McIntyre, Brendan A S; Alev, Cantas; Mechael, Rami; Salci, Kyle R; Lee, Jung Bok; Fiebig-Comyn, Aline; Guezguez, Borhane; Wu, Yuping; Sheng, Guojun; Bhatia, Mickie. Expansive generation of functional airway epithelium from human embryonic stem cells. Stem Cells Translational Medicine. 2014;3(1):7-17. PubMed |
| Piwowarczyk, Katarzyna; Kwiecień, Edyta; Sośniak, Justyna; Zimoląg, Eliza; Guzik, Emiliana; Sroka, Jolanta; Madeja, Zbigniew; Czyż, Jarosław. Fenofibrate Interferes with the Diapedesis of Lung Adenocarcinoma Cells through the Interference with Cx43/EGF-Dependent Intercellular Signaling. Cancers. 2018;10(10) PubMed |
| Sitjà-Bobadilla, Ariadna; Gil-Solsona, Rubén; Estensoro, Itziar; Piazzon, M Carla; Martos-Sitcha, Juan Antonio; Picard-Sánchez, Amparo; Fuentes, Juan; Sancho, Juan Vicente; Calduch-Giner, Josep A; Hernández, Félix; Pérez-Sánchez, Jaume. Disruption of gut integrity and permeability contributes to enteritis in a fish-parasite model: a story told from serum metabolomics. Parasites & Vectors. 2019;12(1):486. PubMed |
| Chen, Qianmin; Tan, Kai Sen; Liu, Jing; Ong, Hsiao Hui; Zhou, Suizi; Huang, Hongming; Chen, Hailing; Ong, Yew Kwang; Thong, Mark; Chow, Vincent T; Qiu, Qianhui; Wang, De-Yun. Host Antiviral Response Suppresses Ciliogenesis and Motile Ciliary Functions in the Nasal Epithelium. Frontiers In Cell And Developmental Biology. 8( 33409274):581340. PubMed |
| Yang, Yue-Ying; Liu, Jing; Liu, Yi-Tong; Ong, Hsiao-Hui; Chen, Qian-Min; Chen, Ce-Belle; Thong, Mark; Xu, Xinni; Zhou, Sui-Zi; Qiu, Qian-Hui; Wang, De-Yun. Moderate Dose Irradiation Induces DNA Damage and Impairments of Barrier and Host Defense in Nasal Epithelial Cells in vitro. Journal Of Inflammation Research. 15( 35783248):3661-3675. PubMed |