Anti TJAP1 pAb (ATL-HPA030166)

Atlas Antibodies

Catalog No.:
ATL-HPA030166-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tight junction associated protein 1 (peripheral)
Gene Name: TJAP1
Alternative Gene Name: PILT, TJP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012296: 90%, ENSRNOG00000018980: 90%
Entrez Gene ID: 93643
Uniprot ID: Q5JTD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS
Gene Sequence RLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQS
Gene ID - Mouse ENSMUSG00000012296
Gene ID - Rat ENSRNOG00000018980
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TJAP1 pAb (ATL-HPA030166)
Datasheet Anti TJAP1 pAb (ATL-HPA030166) Datasheet (External Link)
Vendor Page Anti TJAP1 pAb (ATL-HPA030166) at Atlas Antibodies

Documents & Links for Anti TJAP1 pAb (ATL-HPA030166)
Datasheet Anti TJAP1 pAb (ATL-HPA030166) Datasheet (External Link)
Vendor Page Anti TJAP1 pAb (ATL-HPA030166)