Anti TJAP1 pAb (ATL-HPA030164)

Atlas Antibodies

Catalog No.: ATL-HPA030164-25

Protein Description: tight junction associated protein 1 (peripheral)
Gene Name: TJAP1
Alternative Gene Name: PILT, TJP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012296: 88%, ENSRNOG00000018980: 83%
Entrez Gene ID: 93643
Uniprot ID: Q5JTD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP
• Gene Sequence: GSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLSLVEEGSERARPSPVPSTPASAQASPHHQPSPAPLTLSAP
• Gene ID - Mouse: ENSMUSG00000012296
• Gene ID - Rat: ENSRNOG00000018980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.