Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039704-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: TIPIN
Alternative Gene Name: FLJ20516
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032397: 66%, ENSRNOG00000043068: 59%
Entrez Gene ID: 54962
Uniprot ID: Q9BVW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA |
| Gene Sequence | EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA |
| Gene ID - Mouse | ENSMUSG00000032397 |
| Gene ID - Rat | ENSRNOG00000043068 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) | |
| Datasheet | Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) | |
| Datasheet | Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) |
| Citations for Anti TIPIN pAb (ATL-HPA039704 w/enhanced validation) – 2 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |