Anti TINF2 pAb (ATL-HPA069807)

Atlas Antibodies

Catalog No.:
ATL-HPA069807-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: TERF1 (TRF1)-interacting nuclear factor 2
Gene Name: TINF2
Alternative Gene Name: TIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007589: 66%, ENSRNOG00000020189: 61%
Entrez Gene ID: 26277
Uniprot ID: Q9BSI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
Gene Sequence FEYLCQLEKALPTPQAQQLQDVLSWMQPGVSITSSLAWRQYGVDMGWLLPECSVTDSVNLAEPMEQNPPQQQRL
Gene ID - Mouse ENSMUSG00000007589
Gene ID - Rat ENSRNOG00000020189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TINF2 pAb (ATL-HPA069807)
Datasheet Anti TINF2 pAb (ATL-HPA069807) Datasheet (External Link)
Vendor Page Anti TINF2 pAb (ATL-HPA069807) at Atlas Antibodies

Documents & Links for Anti TINF2 pAb (ATL-HPA069807)
Datasheet Anti TINF2 pAb (ATL-HPA069807) Datasheet (External Link)
Vendor Page Anti TINF2 pAb (ATL-HPA069807)