Anti TINF2 pAb (ATL-HPA059061)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059061-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TINF2
Alternative Gene Name: TIN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007589: 48%, ENSRNOG00000020189: 54%
Entrez Gene ID: 26277
Uniprot ID: Q9BSI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDL |
Gene Sequence | RRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEHAIYTADLAMGTRAASTGKSKSPCQTLGGRALKENPVDL |
Gene ID - Mouse | ENSMUSG00000007589 |
Gene ID - Rat | ENSRNOG00000020189 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TINF2 pAb (ATL-HPA059061) | |
Datasheet | Anti TINF2 pAb (ATL-HPA059061) Datasheet (External Link) |
Vendor Page | Anti TINF2 pAb (ATL-HPA059061) at Atlas Antibodies |
Documents & Links for Anti TINF2 pAb (ATL-HPA059061) | |
Datasheet | Anti TINF2 pAb (ATL-HPA059061) Datasheet (External Link) |
Vendor Page | Anti TINF2 pAb (ATL-HPA059061) |