Anti TIMMDC1 pAb (ATL-HPA055846)

Atlas Antibodies

Catalog No.:
ATL-HPA055846-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane domain containing 1
Gene Name: TIMMDC1
Alternative Gene Name: C3orf1, FLJ22597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002846: 53%, ENSRNOG00000002999: 53%
Entrez Gene ID: 51300
Uniprot ID: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLAN
Gene Sequence AAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLAN
Gene ID - Mouse ENSMUSG00000002846
Gene ID - Rat ENSRNOG00000002999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMMDC1 pAb (ATL-HPA055846)
Datasheet Anti TIMMDC1 pAb (ATL-HPA055846) Datasheet (External Link)
Vendor Page Anti TIMMDC1 pAb (ATL-HPA055846) at Atlas Antibodies

Documents & Links for Anti TIMMDC1 pAb (ATL-HPA055846)
Datasheet Anti TIMMDC1 pAb (ATL-HPA055846) Datasheet (External Link)
Vendor Page Anti TIMMDC1 pAb (ATL-HPA055846)