Anti TIMMDC1 pAb (ATL-HPA053214)

Atlas Antibodies

Catalog No.:
ATL-HPA053214-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane domain containing 1
Gene Name: TIMMDC1
Alternative Gene Name: C3orf1, FLJ22597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002846: 64%, ENSRNOG00000002999: 60%
Entrez Gene ID: 51300
Uniprot ID: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK
Gene Sequence YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK
Gene ID - Mouse ENSMUSG00000002846
Gene ID - Rat ENSRNOG00000002999
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMMDC1 pAb (ATL-HPA053214)
Datasheet Anti TIMMDC1 pAb (ATL-HPA053214) Datasheet (External Link)
Vendor Page Anti TIMMDC1 pAb (ATL-HPA053214) at Atlas Antibodies

Documents & Links for Anti TIMMDC1 pAb (ATL-HPA053214)
Datasheet Anti TIMMDC1 pAb (ATL-HPA053214) Datasheet (External Link)
Vendor Page Anti TIMMDC1 pAb (ATL-HPA053214)
Citations for Anti TIMMDC1 pAb (ATL-HPA053214) – 3 Found
Guarani, Virginia; Paulo, Joao; Zhai, Bo; Huttlin, Edward L; Gygi, Steven P; Harper, J Wade. TIMMDC1/C3orf1 functions as a membrane-embedded mitochondrial complex I assembly factor through association with the MCIA complex. Molecular And Cellular Biology. 2014;34(5):847-61.  PubMed
Formosa, Luke E; Reljic, Boris; Sharpe, Alice J; Hock, Daniella H; Muellner-Wong, Linden; Stroud, David A; Ryan, Michael T. Optic atrophy-associated TMEM126A is an assembly factor for the ND4-module of mitochondrial complex I. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(17)  PubMed
Jackson, Thomas D; Crameri, Jordan J; Muellner-Wong, Linden; Frazier, Ann E; Palmer, Catherine S; Formosa, Luke E; Hock, Daniella H; Fujihara, Kenji M; Stait, Tegan; Sharpe, Alice J; Thorburn, David R; Ryan, Michael T; Stroud, David A; Stojanovski, Diana. Sideroflexin 4 is a complex I assembly factor that interacts with the MCIA complex and is required for the assembly of the ND2 module. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2022;119(13):e2115566119.  PubMed