Anti TIMMDC1 pAb (ATL-HPA053214)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053214-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TIMMDC1
Alternative Gene Name: C3orf1, FLJ22597
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002846: 64%, ENSRNOG00000002999: 60%
Entrez Gene ID: 51300
Uniprot ID: Q9NPL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK |
| Gene Sequence | YSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDK |
| Gene ID - Mouse | ENSMUSG00000002846 |
| Gene ID - Rat | ENSRNOG00000002999 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TIMMDC1 pAb (ATL-HPA053214) | |
| Datasheet | Anti TIMMDC1 pAb (ATL-HPA053214) Datasheet (External Link) |
| Vendor Page | Anti TIMMDC1 pAb (ATL-HPA053214) at Atlas Antibodies |
| Documents & Links for Anti TIMMDC1 pAb (ATL-HPA053214) | |
| Datasheet | Anti TIMMDC1 pAb (ATL-HPA053214) Datasheet (External Link) |
| Vendor Page | Anti TIMMDC1 pAb (ATL-HPA053214) |
| Citations for Anti TIMMDC1 pAb (ATL-HPA053214) – 3 Found |
| Guarani, Virginia; Paulo, Joao; Zhai, Bo; Huttlin, Edward L; Gygi, Steven P; Harper, J Wade. TIMMDC1/C3orf1 functions as a membrane-embedded mitochondrial complex I assembly factor through association with the MCIA complex. Molecular And Cellular Biology. 2014;34(5):847-61. PubMed |
| Formosa, Luke E; Reljic, Boris; Sharpe, Alice J; Hock, Daniella H; Muellner-Wong, Linden; Stroud, David A; Ryan, Michael T. Optic atrophy-associated TMEM126A is an assembly factor for the ND4-module of mitochondrial complex I. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2021;118(17) PubMed |
| Jackson, Thomas D; Crameri, Jordan J; Muellner-Wong, Linden; Frazier, Ann E; Palmer, Catherine S; Formosa, Luke E; Hock, Daniella H; Fujihara, Kenji M; Stait, Tegan; Sharpe, Alice J; Thorburn, David R; Ryan, Michael T; Stroud, David A; Stojanovski, Diana. Sideroflexin 4 is a complex I assembly factor that interacts with the MCIA complex and is required for the assembly of the ND2 module. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2022;119(13):e2115566119. PubMed |