Anti TIMM9 pAb (ATL-HPA002932)

Atlas Antibodies

Catalog No.: ATL-HPA002932-25

Protein Description: translocase of inner mitochondrial membrane 9 homolog (yeast)
Gene Name: TIMM9
Alternative Gene Name: TIM9A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021079: 98%, ENSRNOG00000008222: 99%
Entrez Gene ID: 26520
Uniprot ID: Q9Y5J7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
• Gene Sequence: AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
• Gene ID - Mouse: ENSMUSG00000021079
• Gene ID - Rat: ENSRNOG00000008222
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti TIMM9 pAb (ATL-HPA002932) – 1 Found

Sotgia, Federica; Whitaker-Menezes, Diana; Martinez-Outschoorn, Ubaldo E; Salem, Ahmed F; Tsirigos, Aristotelis; Lamb, Rebecca; Sneddon, Sharon; Hulit, James; Howell, Anthony; Lisanti, Michael P. Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle (Georgetown, Tex.). 2012;11(23):4390-401.