Anti TIMM50 pAb (ATL-HPA056448)

Atlas Antibodies

Catalog No.:
ATL-HPA056448-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
Gene Name: TIMM50
Alternative Gene Name: TIM50L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003438: 99%, ENSRNOG00000037638: 99%
Entrez Gene ID: 92609
Uniprot ID: Q3ZCQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
Gene Sequence TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC
Gene ID - Mouse ENSMUSG00000003438
Gene ID - Rat ENSRNOG00000037638
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMM50 pAb (ATL-HPA056448)
Datasheet Anti TIMM50 pAb (ATL-HPA056448) Datasheet (External Link)
Vendor Page Anti TIMM50 pAb (ATL-HPA056448) at Atlas Antibodies

Documents & Links for Anti TIMM50 pAb (ATL-HPA056448)
Datasheet Anti TIMM50 pAb (ATL-HPA056448) Datasheet (External Link)
Vendor Page Anti TIMM50 pAb (ATL-HPA056448)