Anti TIMM44 pAb (ATL-HPA073108)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073108-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: TIMM44
Alternative Gene Name: TIM44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002949: 93%, ENSRNOG00000001058: 94%
Entrez Gene ID: 10469
Uniprot ID: O43615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATY |
Gene Sequence | TDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATY |
Gene ID - Mouse | ENSMUSG00000002949 |
Gene ID - Rat | ENSRNOG00000001058 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti TIMM44 pAb (ATL-HPA073108) | |
Datasheet | Anti TIMM44 pAb (ATL-HPA073108) Datasheet (External Link) |
Vendor Page | Anti TIMM44 pAb (ATL-HPA073108) at Atlas Antibodies |
Documents & Links for Anti TIMM44 pAb (ATL-HPA073108) | |
Datasheet | Anti TIMM44 pAb (ATL-HPA073108) Datasheet (External Link) |
Vendor Page | Anti TIMM44 pAb (ATL-HPA073108) |