Anti TIMM23 pAb (ATL-HPA031408)

Atlas Antibodies

Catalog No.:
ATL-HPA031408-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane 23 homolog (yeast)
Gene Name: TIMM23
Alternative Gene Name: TIM23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069622: 98%, ENSRNOG00000019811: 97%
Entrez Gene ID: 100287932
Uniprot ID: O14925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL
Gene Sequence TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL
Gene ID - Mouse ENSMUSG00000069622
Gene ID - Rat ENSRNOG00000019811
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMM23 pAb (ATL-HPA031408)
Datasheet Anti TIMM23 pAb (ATL-HPA031408) Datasheet (External Link)
Vendor Page Anti TIMM23 pAb (ATL-HPA031408) at Atlas Antibodies

Documents & Links for Anti TIMM23 pAb (ATL-HPA031408)
Datasheet Anti TIMM23 pAb (ATL-HPA031408) Datasheet (External Link)
Vendor Page Anti TIMM23 pAb (ATL-HPA031408)