Anti TIMM23 pAb (ATL-HPA031408)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031408-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: TIMM23
Alternative Gene Name: TIM23
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069622: 98%, ENSRNOG00000019811: 97%
Entrez Gene ID: 100287932
Uniprot ID: O14925
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL |
| Gene Sequence | TRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL |
| Gene ID - Mouse | ENSMUSG00000069622 |
| Gene ID - Rat | ENSRNOG00000019811 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti TIMM23 pAb (ATL-HPA031408) | |
| Datasheet | Anti TIMM23 pAb (ATL-HPA031408) Datasheet (External Link) |
| Vendor Page | Anti TIMM23 pAb (ATL-HPA031408) at Atlas Antibodies |
| Documents & Links for Anti TIMM23 pAb (ATL-HPA031408) | |
| Datasheet | Anti TIMM23 pAb (ATL-HPA031408) Datasheet (External Link) |
| Vendor Page | Anti TIMM23 pAb (ATL-HPA031408) |