Anti TIMM10B pAb (ATL-HPA052265)

Atlas Antibodies

Catalog No.:
ATL-HPA052265-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: translocase of inner mitochondrial membrane 10 homolog B (yeast)
Gene Name: TIMM10B
Alternative Gene Name: FXC1, TIM10B, Tim9b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110234: 93%, ENSRNOG00000050846: 95%
Entrez Gene ID: 26515
Uniprot ID: Q9Y5J6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Gene Sequence QQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPGVAAEQPGVSPSGS
Gene ID - Mouse ENSMUSG00000110234
Gene ID - Rat ENSRNOG00000050846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIMM10B pAb (ATL-HPA052265)
Datasheet Anti TIMM10B pAb (ATL-HPA052265) Datasheet (External Link)
Vendor Page Anti TIMM10B pAb (ATL-HPA052265) at Atlas Antibodies

Documents & Links for Anti TIMM10B pAb (ATL-HPA052265)
Datasheet Anti TIMM10B pAb (ATL-HPA052265) Datasheet (External Link)
Vendor Page Anti TIMM10B pAb (ATL-HPA052265)