Anti TIGD7 pAb (ATL-HPA041474)

Atlas Antibodies

Catalog No.:
ATL-HPA041474-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tigger transposable element derived 7
Gene Name: TIGD7
Alternative Gene Name: Sancho
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038663: 27%, ENSRNOG00000019278: 27%
Entrez Gene ID: 91151
Uniprot ID: Q6NT04
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGDYREILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDFVDATPEF
Gene Sequence HGDYREILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDFVDATPEF
Gene ID - Mouse ENSMUSG00000038663
Gene ID - Rat ENSRNOG00000019278
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIGD7 pAb (ATL-HPA041474)
Datasheet Anti TIGD7 pAb (ATL-HPA041474) Datasheet (External Link)
Vendor Page Anti TIGD7 pAb (ATL-HPA041474) at Atlas Antibodies

Documents & Links for Anti TIGD7 pAb (ATL-HPA041474)
Datasheet Anti TIGD7 pAb (ATL-HPA041474) Datasheet (External Link)
Vendor Page Anti TIGD7 pAb (ATL-HPA041474)