Anti TIGD2 pAb (ATL-HPA071168)

Atlas Antibodies

Catalog No.:
ATL-HPA071168-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: tigger transposable element derived 2
Gene Name: TIGD2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049232: 81%, ENSRNOG00000038449: 81%
Entrez Gene ID: 166815
Uniprot ID: Q4W5G0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, ChIP
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIENIDQWFDSRSSDSSCQVLTD
Gene Sequence KSSTITKAWKKLFPGNEENSGMNIDEGAILAANLATVLQNTEECEHVDIENIDQWFDSRSSDSSCQVLTD
Gene ID - Mouse ENSMUSG00000049232
Gene ID - Rat ENSRNOG00000038449
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIGD2 pAb (ATL-HPA071168)
Datasheet Anti TIGD2 pAb (ATL-HPA071168) Datasheet (External Link)
Vendor Page Anti TIGD2 pAb (ATL-HPA071168) at Atlas Antibodies

Documents & Links for Anti TIGD2 pAb (ATL-HPA071168)
Datasheet Anti TIGD2 pAb (ATL-HPA071168) Datasheet (External Link)
Vendor Page Anti TIGD2 pAb (ATL-HPA071168)