Anti TIFAB pAb (ATL-HPA049372)

Atlas Antibodies

Catalog No.:
ATL-HPA049372-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: TRAF-interacting protein with forkhead-associated domain, family member B
Gene Name: TIFAB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049625: 69%, ENSRNOG00000011947: 69%
Entrez Gene ID: 497189
Uniprot ID: Q6ZNK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ
Gene Sequence PLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQ
Gene ID - Mouse ENSMUSG00000049625
Gene ID - Rat ENSRNOG00000011947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIFAB pAb (ATL-HPA049372)
Datasheet Anti TIFAB pAb (ATL-HPA049372) Datasheet (External Link)
Vendor Page Anti TIFAB pAb (ATL-HPA049372) at Atlas Antibodies

Documents & Links for Anti TIFAB pAb (ATL-HPA049372)
Datasheet Anti TIFAB pAb (ATL-HPA049372) Datasheet (External Link)
Vendor Page Anti TIFAB pAb (ATL-HPA049372)