Anti TIAF1 pAb (ATL-HPA051129)

Atlas Antibodies

Catalog No.:
ATL-HPA051129-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: TGFB1-induced anti-apoptotic factor 1
Gene Name: TIAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020863: 30%, ENSRNOG00000012422: 28%
Entrez Gene ID: 9220
Uniprot ID: O95411
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCV
Gene Sequence MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCV
Gene ID - Mouse ENSMUSG00000020863
Gene ID - Rat ENSRNOG00000012422
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti TIAF1 pAb (ATL-HPA051129)
Datasheet Anti TIAF1 pAb (ATL-HPA051129) Datasheet (External Link)
Vendor Page Anti TIAF1 pAb (ATL-HPA051129) at Atlas Antibodies

Documents & Links for Anti TIAF1 pAb (ATL-HPA051129)
Datasheet Anti TIAF1 pAb (ATL-HPA051129) Datasheet (External Link)
Vendor Page Anti TIAF1 pAb (ATL-HPA051129)