Anti THY1 pAb (ATL-HPA003733 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003733-25

Protein Description: Thy-1 cell surface antigen
Gene Name: THY1
Alternative Gene Name: CD90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032011: 64%, ENSRNOG00000006604: 68%
Entrez Gene ID: 7070
Uniprot ID: P04216
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
• Gene Sequence: VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL
• Gene ID - Mouse: ENSMUSG00000032011
• Gene ID - Rat: ENSRNOG00000006604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) – 2 Found

Zhang, Dan-Hua; Yang, Zhu-Lin; Zhou, En-Xiang; Miao, Xiong-Ying; Zou, Qiong; Li, Jing-He; Liang, Lu-Feng; Zeng, Gui-Xiang; Chen, Sen-Lin. Overexpression of Thy1 and ITGA6 is associated with invasion, metastasis and poor prognosis in human gallbladder carcinoma. Oncology Letters. 2016;12(6):5136-5144. 

Akbar, Moeed; McLean, Michael; Garcia-Melchor, Emma; Crowe, Lindsay An; McMillan, Paul; Fazzi, Umberto G; Martin, David; Arthur, Angus; Reilly, James H; McInnes, Iain B; Millar, Neal L. Fibroblast activation and inflammation in frozen shoulder. Plos One. 14(4):e0215301.