Anti THY1 pAb (ATL-HPA003733 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003733-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: THY1
Alternative Gene Name: CD90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032011: 64%, ENSRNOG00000006604: 68%
Entrez Gene ID: 7070
Uniprot ID: P04216
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL |
| Gene Sequence | VTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWL |
| Gene ID - Mouse | ENSMUSG00000032011 |
| Gene ID - Rat | ENSRNOG00000006604 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) | |
| Datasheet | Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) | |
| Datasheet | Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) |
| Citations for Anti THY1 pAb (ATL-HPA003733 w/enhanced validation) – 2 Found |
| Zhang, Dan-Hua; Yang, Zhu-Lin; Zhou, En-Xiang; Miao, Xiong-Ying; Zou, Qiong; Li, Jing-He; Liang, Lu-Feng; Zeng, Gui-Xiang; Chen, Sen-Lin. Overexpression of Thy1 and ITGA6 is associated with invasion, metastasis and poor prognosis in human gallbladder carcinoma. Oncology Letters. 2016;12(6):5136-5144. PubMed |
| Akbar, Moeed; McLean, Michael; Garcia-Melchor, Emma; Crowe, Lindsay An; McMillan, Paul; Fazzi, Umberto G; Martin, David; Arthur, Angus; Reilly, James H; McInnes, Iain B; Millar, Neal L. Fibroblast activation and inflammation in frozen shoulder. Plos One. 14(4):e0215301. PubMed |