Anti THSD7B pAb (ATL-HPA056745)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056745-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: THSD7B
Alternative Gene Name: KIAA1679
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042581: 84%, ENSRNOG00000003878: 82%
Entrez Gene ID: 80731
Uniprot ID: Q9C0I4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCGEGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSV |
| Gene Sequence | PTQGEGRPCPTELTQEKTCPVTPCYSWVLGNWSACKLEGGDCGEGVQIRSLSCMVHSGSISHAAGRVEDALCGEMPFQDSILKQLCSV |
| Gene ID - Mouse | ENSMUSG00000042581 |
| Gene ID - Rat | ENSRNOG00000003878 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THSD7B pAb (ATL-HPA056745) | |
| Datasheet | Anti THSD7B pAb (ATL-HPA056745) Datasheet (External Link) |
| Vendor Page | Anti THSD7B pAb (ATL-HPA056745) at Atlas Antibodies |
| Documents & Links for Anti THSD7B pAb (ATL-HPA056745) | |
| Datasheet | Anti THSD7B pAb (ATL-HPA056745) Datasheet (External Link) |
| Vendor Page | Anti THSD7B pAb (ATL-HPA056745) |