Anti THSD1 pAb (ATL-HPA012611)

Atlas Antibodies

Catalog No.: ATL-HPA012611-25

Protein Description: thrombospondin, type I, domain containing 1
Gene Name: THSD1
Alternative Gene Name: TMTSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031480: 82%, ENSRNOG00000012108: 82%
Entrez Gene ID: 55901
Uniprot ID: Q9NS62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ
• Gene Sequence: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ
• Gene ID - Mouse: ENSMUSG00000031480
• Gene ID - Rat: ENSRNOG00000012108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.