Anti THRB pAb (ATL-HPA061035)

Atlas Antibodies

Catalog No.:
ATL-HPA061035-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: thyroid hormone receptor, beta
Gene Name: THRB
Alternative Gene Name: ERBA-BETA, ERBA2, GRTH, NR1A2, PRTH, THR1, THRB1, THRB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021779: 82%, ENSRNOG00000006649: 82%
Entrez Gene ID: 7068
Uniprot ID: P10828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
Gene Sequence MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
Gene ID - Mouse ENSMUSG00000021779
Gene ID - Rat ENSRNOG00000006649
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THRB pAb (ATL-HPA061035)
Datasheet Anti THRB pAb (ATL-HPA061035) Datasheet (External Link)
Vendor Page Anti THRB pAb (ATL-HPA061035) at Atlas Antibodies

Documents & Links for Anti THRB pAb (ATL-HPA061035)
Datasheet Anti THRB pAb (ATL-HPA061035) Datasheet (External Link)
Vendor Page Anti THRB pAb (ATL-HPA061035)