Anti THRB pAb (ATL-HPA061035)

Atlas Antibodies

SKU: ATL-HPA061035-25

• 

Protein Description: thyroid hormone receptor, beta
Gene Name: THRB
Alternative Gene Name: ERBA-BETA, ERBA2, GRTH, NR1A2, PRTH, THR1, THRB1, THRB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021779: 82%, ENSRNOG00000006649: 82%
Entrez Gene ID: 7068
Uniprot ID: P10828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
• Gene Sequence: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK
• Gene ID - Mouse: ENSMUSG00000021779
• Gene ID - Rat: ENSRNOG00000006649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.