Anti THRAP3 pAb (ATL-HPA063765)

Atlas Antibodies

Catalog No.:
ATL-HPA063765-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: thyroid hormone receptor associated protein 3
Gene Name: THRAP3
Alternative Gene Name: TRAP150
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043962: 93%, ENSRNOG00000009977: 93%
Entrez Gene ID: 9967
Uniprot ID: Q9Y2W1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL
Gene Sequence RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL
Gene ID - Mouse ENSMUSG00000043962
Gene ID - Rat ENSRNOG00000009977
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THRAP3 pAb (ATL-HPA063765)
Datasheet Anti THRAP3 pAb (ATL-HPA063765) Datasheet (External Link)
Vendor Page Anti THRAP3 pAb (ATL-HPA063765) at Atlas Antibodies

Documents & Links for Anti THRAP3 pAb (ATL-HPA063765)
Datasheet Anti THRAP3 pAb (ATL-HPA063765) Datasheet (External Link)
Vendor Page Anti THRAP3 pAb (ATL-HPA063765)