Anti THOP1 pAb (ATL-HPA035262)

Atlas Antibodies

Catalog No.:
ATL-HPA035262-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: thimet oligopeptidase 1
Gene Name: THOP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004929: 78%, ENSRNOG00000019924: 76%
Entrez Gene ID: 7064
Uniprot ID: P52888
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKA
Gene Sequence AACAGDMADAASPCSVVNDLRWDLSAQQIEERTRELIEQTKRVYDQVGTQEFEDVSYESTLKA
Gene ID - Mouse ENSMUSG00000004929
Gene ID - Rat ENSRNOG00000019924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THOP1 pAb (ATL-HPA035262)
Datasheet Anti THOP1 pAb (ATL-HPA035262) Datasheet (External Link)
Vendor Page Anti THOP1 pAb (ATL-HPA035262) at Atlas Antibodies

Documents & Links for Anti THOP1 pAb (ATL-HPA035262)
Datasheet Anti THOP1 pAb (ATL-HPA035262) Datasheet (External Link)
Vendor Page Anti THOP1 pAb (ATL-HPA035262)