Anti THEGL pAb (ATL-HPA066627)

Atlas Antibodies

Catalog No.:
ATL-HPA066627-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: theg spermatid protein like
Gene Name: THEGL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029248: 28%, ENSRNOG00000022598: 28%
Entrez Gene ID: 100506564
Uniprot ID: P0DJG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGQVSTEISTCSEVFQKPIVLRILDTHRELEESEDPEKHENPEEPEEVREQDQRDESEECDEPHESYEPHAPYAPHKPRDSYAPYELHG
Gene Sequence DGQVSTEISTCSEVFQKPIVLRILDTHRELEESEDPEKHENPEEPEEVREQDQRDESEECDEPHESYEPHAPYAPHKPRDSYAPYELHG
Gene ID - Mouse ENSMUSG00000029248
Gene ID - Rat ENSRNOG00000022598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THEGL pAb (ATL-HPA066627)
Datasheet Anti THEGL pAb (ATL-HPA066627) Datasheet (External Link)
Vendor Page Anti THEGL pAb (ATL-HPA066627) at Atlas Antibodies

Documents & Links for Anti THEGL pAb (ATL-HPA066627)
Datasheet Anti THEGL pAb (ATL-HPA066627) Datasheet (External Link)
Vendor Page Anti THEGL pAb (ATL-HPA066627)