Anti THBS3 pAb (ATL-HPA073242)

Atlas Antibodies

Catalog No.:
ATL-HPA073242-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: thrombospondin 3
Gene Name: THBS3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028047: 95%, ENSRNOG00000059903: 96%
Entrez Gene ID: 7059
Uniprot ID: P49746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS
Gene Sequence VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS
Gene ID - Mouse ENSMUSG00000028047
Gene ID - Rat ENSRNOG00000059903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THBS3 pAb (ATL-HPA073242)
Datasheet Anti THBS3 pAb (ATL-HPA073242) Datasheet (External Link)
Vendor Page Anti THBS3 pAb (ATL-HPA073242) at Atlas Antibodies

Documents & Links for Anti THBS3 pAb (ATL-HPA073242)
Datasheet Anti THBS3 pAb (ATL-HPA073242) Datasheet (External Link)
Vendor Page Anti THBS3 pAb (ATL-HPA073242)