Anti THAP8 pAb (ATL-HPA064056)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064056-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: THAP8
Alternative Gene Name: FLJ32891
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 45%, ENSRNOG00000018351: 45%
Entrez Gene ID: 199745
Uniprot ID: Q8NA92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS |
Gene Sequence | MPKYCRAPNCSNTAGRLGADNRPVSFYKFPLKDGPRLQAWLQHMGCEHWVPSCHQHLCSEHFTPS |
Gene ID - Mouse | ENSMUSG00000026279 |
Gene ID - Rat | ENSRNOG00000018351 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti THAP8 pAb (ATL-HPA064056) | |
Datasheet | Anti THAP8 pAb (ATL-HPA064056) Datasheet (External Link) |
Vendor Page | Anti THAP8 pAb (ATL-HPA064056) at Atlas Antibodies |
Documents & Links for Anti THAP8 pAb (ATL-HPA064056) | |
Datasheet | Anti THAP8 pAb (ATL-HPA064056) Datasheet (External Link) |
Vendor Page | Anti THAP8 pAb (ATL-HPA064056) |