Anti THAP7 pAb (ATL-HPA003083)

Atlas Antibodies

Catalog No.:
ATL-HPA003083-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 7
Gene Name: THAP7
Alternative Gene Name: MGC10963
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022760: 91%, ENSRNOG00000037967: 89%
Entrez Gene ID: 80764
Uniprot ID: Q9BT49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPEVSRLRRCRKRCSEGRGPTTPFSPPPPADVTCFP
Gene Sequence GISFHRLPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVGISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPPEVSRLRRCRKRCSEGRGPTTPFSPPPPADVTCFP
Gene ID - Mouse ENSMUSG00000022760
Gene ID - Rat ENSRNOG00000037967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP7 pAb (ATL-HPA003083)
Datasheet Anti THAP7 pAb (ATL-HPA003083) Datasheet (External Link)
Vendor Page Anti THAP7 pAb (ATL-HPA003083) at Atlas Antibodies

Documents & Links for Anti THAP7 pAb (ATL-HPA003083)
Datasheet Anti THAP7 pAb (ATL-HPA003083) Datasheet (External Link)
Vendor Page Anti THAP7 pAb (ATL-HPA003083)
Citations for Anti THAP7 pAb (ATL-HPA003083) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed