Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035767-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 6
Gene Name: THAP6
Alternative Gene Name: MGC30052
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020330: 30%, ENSRNOG00000058724: 78%
Entrez Gene ID: 152815
Uniprot ID: Q8TBB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS
Gene Sequence LKHKLDHVIGELEDTKESLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLDTFCWDCCQESIEQDYIS
Gene ID - Mouse ENSMUSG00000020330
Gene ID - Rat ENSRNOG00000058724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation)
Datasheet Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation)
Datasheet Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation)
Citations for Anti THAP6 pAb (ATL-HPA035767 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed