Anti THAP5 pAb (ATL-HPA051488)

Atlas Antibodies

Catalog No.: ATL-HPA051488-25

Protein Description: THAP domain containing 5
Gene Name: THAP5
Alternative Gene Name: DKFZp313O1132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049571: 28%, ENSRNOG00000016427: 31%
Entrez Gene ID: 168451
Uniprot ID: Q7Z6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSI
• Gene Sequence: EDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSI
• Gene ID - Mouse: ENSMUSG00000049571
• Gene ID - Rat: ENSRNOG00000016427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.