Anti THAP5 pAb (ATL-HPA051488)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051488-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: THAP5
Alternative Gene Name: DKFZp313O1132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049571: 28%, ENSRNOG00000016427: 31%
Entrez Gene ID: 168451
Uniprot ID: Q7Z6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSI |
Gene Sequence | EDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEESFVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSI |
Gene ID - Mouse | ENSMUSG00000049571 |
Gene ID - Rat | ENSRNOG00000016427 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti THAP5 pAb (ATL-HPA051488) | |
Datasheet | Anti THAP5 pAb (ATL-HPA051488) Datasheet (External Link) |
Vendor Page | Anti THAP5 pAb (ATL-HPA051488) at Atlas Antibodies |
Documents & Links for Anti THAP5 pAb (ATL-HPA051488) | |
Datasheet | Anti THAP5 pAb (ATL-HPA051488) Datasheet (External Link) |
Vendor Page | Anti THAP5 pAb (ATL-HPA051488) |