Anti THAP5 pAb (ATL-HPA043170)

Atlas Antibodies

Catalog No.:
ATL-HPA043170-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 5
Gene Name: THAP5
Alternative Gene Name: DKFZp313O1132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041649: 38%, ENSRNOG00000039057: 35%
Entrez Gene ID: 168451
Uniprot ID: Q7Z6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLANPNFTSNSMEIKSAQENPFLFSTIKQTVEELNTNKE
Gene Sequence YLANPNFTSNSMEIKSAQENPFLFSTIKQTVEELNTNKE
Gene ID - Mouse ENSMUSG00000041649
Gene ID - Rat ENSRNOG00000039057
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP5 pAb (ATL-HPA043170)
Datasheet Anti THAP5 pAb (ATL-HPA043170) Datasheet (External Link)
Vendor Page Anti THAP5 pAb (ATL-HPA043170) at Atlas Antibodies

Documents & Links for Anti THAP5 pAb (ATL-HPA043170)
Datasheet Anti THAP5 pAb (ATL-HPA043170) Datasheet (External Link)
Vendor Page Anti THAP5 pAb (ATL-HPA043170)