Anti THAP5 pAb (ATL-HPA043170)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043170-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: THAP5
Alternative Gene Name: DKFZp313O1132
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041649: 38%, ENSRNOG00000039057: 35%
Entrez Gene ID: 168451
Uniprot ID: Q7Z6K1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YLANPNFTSNSMEIKSAQENPFLFSTIKQTVEELNTNKE |
| Gene Sequence | YLANPNFTSNSMEIKSAQENPFLFSTIKQTVEELNTNKE |
| Gene ID - Mouse | ENSMUSG00000041649 |
| Gene ID - Rat | ENSRNOG00000039057 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti THAP5 pAb (ATL-HPA043170) | |
| Datasheet | Anti THAP5 pAb (ATL-HPA043170) Datasheet (External Link) |
| Vendor Page | Anti THAP5 pAb (ATL-HPA043170) at Atlas Antibodies |
| Documents & Links for Anti THAP5 pAb (ATL-HPA043170) | |
| Datasheet | Anti THAP5 pAb (ATL-HPA043170) Datasheet (External Link) |
| Vendor Page | Anti THAP5 pAb (ATL-HPA043170) |