Anti THAP4 pAb (ATL-HPA053448)

Atlas Antibodies

Catalog No.: ATL-HPA053448-25

Protein Description: THAP domain containing 4
Gene Name: THAP4
Alternative Gene Name: CGI-36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 74%, ENSRNOG00000018351: 73%
Entrez Gene ID: 51078
Uniprot ID: Q8WY91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DAGDESATSSIEGGVTDKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPIDRKRLKKDVEPSCSGSSLGPDKGLAQSPPSSSLT
• Gene Sequence: DAGDESATSSIEGGVTDKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPIDRKRLKKDVEPSCSGSSLGPDKGLAQSPPSSSLT
• Gene ID - Mouse: ENSMUSG00000026279
• Gene ID - Rat: ENSRNOG00000018351
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.