Anti THAP4 pAb (ATL-HPA044982)

Atlas Antibodies

Catalog No.:
ATL-HPA044982-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: THAP domain containing 4
Gene Name: THAP4
Alternative Gene Name: CGI-36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026279: 93%, ENSRNOG00000018351: 93%
Entrez Gene ID: 51078
Uniprot ID: Q8WY91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS
Gene Sequence EPLSWMLGTWLSDPPGAGTYPTLQPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGVVEVEEGEVNGQELCIASHS
Gene ID - Mouse ENSMUSG00000026279
Gene ID - Rat ENSRNOG00000018351
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti THAP4 pAb (ATL-HPA044982)
Datasheet Anti THAP4 pAb (ATL-HPA044982) Datasheet (External Link)
Vendor Page Anti THAP4 pAb (ATL-HPA044982) at Atlas Antibodies

Documents & Links for Anti THAP4 pAb (ATL-HPA044982)
Datasheet Anti THAP4 pAb (ATL-HPA044982) Datasheet (External Link)
Vendor Page Anti THAP4 pAb (ATL-HPA044982)